Biopharma

Bacterial Inclusion Body (IB) ·          Inclusion body (IBs) are partially folded protein aggregate. When level of expression of protein goes beyond 2% of the total cellular proteins it leads to formation of inclusion body. It  contains mostly single type   polypeptides and very little amount of host protein components, DNA and RNA fragments. ·         IBs are found in cytoplasm, if secretion signal used it can produces in periplasm also. ·         IBs are formed due to overexpression of heterologous protein, which are unable to solubilize in  cytoplasm and form aggregates.           ·         Bacterial cytoplasm having reduced environment hence di-sulfide bonds of proteins are not formed and proteins remain unfolded/partial folded.     ·         Protein in IBs have native like secondary structure. Proteins i n IBs are aggregated by ionic and hydrophobic interaction. ·          IBs reflect light so it can be visualized by phase contrast microscopy. ·    

GCSF (Granulocyte Colony Stimulating Factor) Generic Name:  Filgrastim Other Names:  G-CSF, granulocyte-colony stimulating factor Chemical Formula : C 845 H 1343 N 223 O 243 S 9                 Mol. Wt. :                   GCSF:  18799Da                   PEG-GCSF:  38800Da Half life in Human body,                                            GCSF: 3 to 4 hours                                           Peg GCSF: 15 to 80 hours  Amino acid sequence: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP GCSF is belongs to CSF (colony stimulating family). There are three protein in this family CSF-1 is macrophage colony stimulating factor (M-CSF), CSF-2 is granulocyte macrophage colony stimulating factor (GM-CSF), CSF-3 is granulocyte colony stimulating factor (G-CSF). That's why GCSF also known as CSF3 (Colony Stimulating Factor 3). GCSF na